scholarly journals Rectal methods of delivery of medical drugs with a protein nature in the therapies of tumor disease

2021 ◽  
Vol 11 (1) ◽  
pp. 18-22
Author(s):  
Jandos Ukibayev ◽  
Ubaidilla Datkhayev ◽  
Diyas Myrzakozha ◽  
Alexander Frantsev ◽  
Elmira Karlova ◽  
...  
Keyword(s):  
Protein Nature

Progestin receptors in prolactin and growth hormone producing tumours in rats

1982 ◽  
Vol 100 (1) ◽  
pp. 25-30 ◽  
Author(s):  
Oddvar Naess ◽  
Egil Haug ◽  
Arne Attramadal ◽  
Kaare M. Gautvik
Keyword(s):  
Growth Hormone ◽  
Glucocorticoid Receptors ◽  
Progesterone Receptors ◽  
Pituitary Tumour ◽  
Tumour Cells ◽  
Female Rats ◽  
Progestin Receptors ◽  
High Affinity ◽  
Protein Nature ◽  
Specific Receptors

Abstract. Progesterone and corticosterone have a similar effect on the production of growth hormone (GH) and prolactin (Prl) by pituitary tumour cells (GH3 cells) in culture. Previously we have shown that progesterone has a high affinity for the glucocorticoid receptors in these cells. Progesterone may therefore exert its effects through binding to the glucocorticoid receptor. The aim of the present study was to investigate if the GH3 tumour cells and an oestrogen induced pituitary tumour, which also produce GH and Prl, possess specific receptors for progesterone. Both the GH3 tumours and the oestrogen induced pituitary tumour were in fact found to possess cytoplasmatic receptor molecules for progesterone by using the potent progestin R5020 as a marker. Isoelectric focusing revealed one binding component (pH 5.9), which was of protein nature. The binding was of high affinity (Kd 2 × 10−9 mol/l). In the oestrogen induced tumour, the maximal binding was 70 fmol/mg cytosol protein. In female rats with GH3 tumours the binding was 55 fmol/mg cytosol protein. Priming of the animals with 1 mg oestradiol-valerate increased the binding to 116 fmol/mg cytosol protein, whereas very little binding was found in GH3 tumours from rats castrated 7 days before sacrifice. The receptors in the oestrogen induced pituitary tumour and the GH3 tumours exhibited high affinity for R5020 and progesterone, whereas corticosterone had no significant affinity for the receptors. Using exchange assay, it was demonstrated that the cytoplasmic progestin receptors could be translocated to the nucleus after administration of progesterone to the animals. Thus, the presence of specific progesterone receptors, different from the glucocorticoid receptors, strongly indicates that the effects of progesterone on GH and Prl production are mediated through the progesterone receptors.

An Examination of Nostoc for Nuclear Materials

1927 ◽  
Vol 4 (3) ◽  
pp. 301-304
Author(s):  
F. A. MOCKERIDGE
Keyword(s):  
Nucleic Acid ◽  
Green Plant ◽  
Nuclear Materials ◽  
Promoting Effect ◽  
Protein Nature ◽  
Growth Promoting

1. Although nucleic acid could not be extracted from Nostoc, all of its constituent radicles, viz. phosphate, pentose, adenine, guanine, cytosine and uracil, were extracted in quantities sufficient to allow of identification. 2. This supports the view that chromatin, a substance of nucleo-protein nature, occurs in the cyanophycean cell, which contains no definite nucleus. 3. The writer suggests tentatively that in the absence of a highly organised nucleus delimited by a membrane, the nuclear materials may more readily diffuse out of the cell and exert a growth-promoting effect on neighbouring plants. This suggestion is supported by the fact that other enucleate organisms, as Saccharomyces and Azotobacter, which contain nucleic acid or its derivatives, show a marked growth-promoting effect on the green plant.

scholarly journals Michael Heidelberger and the demystification of antibodies

2006 ◽  
Vol 203 (1) ◽  
pp. 5-5 ◽  
Author(s):  
Heather L. Van Epps
Keyword(s):  
Precipitin Reaction ◽  
Protein Nature ◽  
Oswald Avery

Having defined the protein nature of antibodies under the tutelage of Oswald Avery, Michael Heidelberger was the first to apply mathematics to the reaction of antibodies and their antigens (the “precipitin reaction”). Heidelberger's calculations launched decades of research that helped reveal the specificity, function, and origin of antibodies.

scholarly journals DEVELOPMENT OF RECOMBINANT PEPTIDE TECHNOLOGY WITH ANTIMICROBIAL PROPERTIES OF A BROAD ACTION SPECTRUM

2017 ◽  
pp. 3-14
Author(s):  
Alexander Prosekov ◽  
Alexander Prosekov ◽  
Olga Babich ◽  
Olga Babich ◽  
Irina Milenteva ◽  
...  
Keyword(s):  
Molecular Weight ◽  
Ammonium Sulfate ◽  
Action Spectrum ◽  
Antimicrobial Properties ◽  
Hplc Method ◽  
Salting Out ◽  
Antimicrobial Spectrum ◽  
Recombinant Peptide ◽  
Isolation And Purification ◽  
Protein Nature

Bacteriocins are antibacterial, mainly complex, substances of protein nature. The promising strains producing bacteriocins used in the food industry are lactic acid microorganisms. This study examines the development of a technology for the production of a recombinant peptide with broad-spectrum antimicrobial properties. An important step is the isolation and purification of the recombinant peptide. It has been proved that the highest antimicrobial activity is manifested by a recombinant peptide isolated by a method based on salting out with ammonium sulfate. During the purification of the recombinant bacteriocin preparation, three kinds of columns were used. In the purification process, the volume of bacteriocin produced decreases 3-fold, while the RU/mL increases 3-fold, and RU/mg increases 6-fold. Purification allows the use of a smaller amount of recombinant bacteriocin in technologies with greater efficacy. Based on the results of determining the molecular weight and purity of the recombinant bacteriocin, it was found that the molecular weight of the recombinant bacteriocin having the amino acid sequence: KYYGNGVTCCKHSCSVDXGKASSCIINNGAMAXATGGH GGNHCCGMSRYIQGIPDFLRGYLHGISSANKHKKGRL, is 13 kDa. A technology for the preparation of a broad-action antimicrobial spectrum peptide has been developed. The process of production of antimicrobial peptide includes such stages as: cultivation of the recombinant strain of Escherichia coli BL21DE3; separation of biomass from the nutrient medium; precipitation of bacteriocins by ammonium sulfate; centrifugation; washing the precipitate; centrifugation at 4200 rpm and separation of the preparation; purification of bacteriocins by HPLC method; packing in bags of polymeric and combined materials; storage at a temperature of 18±2°C for 12 months.

scholarly journals Understanding the impact of moderate-intensity pulsed electric fields (MIPEF) on structural and functional characteristics of pea, rice and gluten concentrates

2020 ◽  
Vol 13 (12) ◽  
pp. 2145-2155
Author(s):  
Sofia Melchior ◽  
Sonia Calligaris ◽  
Giulia Bisson ◽  
Lara Manzocco
Keyword(s):  
Electric Fields ◽  
Functional Properties ◽  
Structural Changes ◽  
Pulsed Electric Fields ◽  
Moderate Intensity ◽  
Intramolecular Rearrangement ◽  
Structural Modifications ◽  
Protein Concentrates ◽  
Protein Nature ◽  
The Impact

Abstract Aim The effect of moderate-intensity pulsed electric fields (MIPEF) was evaluated on vegetable protein concentrates from pea, rice, and gluten. Methods Five percent (w/w) suspensions of protein concentrates (pH 5 and 6) were exposed to up to 60,000 MIPEF pulses at 1.65 kV/cm. Both structural modifications (absorbance at 280 nm, free sulfhydryl groups, FT-IR-spectra) and functional properties (solubility, water and oil holding capacity, foamability) were analyzed. Results MIPEF was able to modify protein structure by inducing unfolding, intramolecular rearrangement, and formation of aggregates. However, these effects were strongly dependent on protein nature and pH. In the case of rice and pea samples, structural changes were associated with negligible modifications in functional properties. By contrast, noticeable changes in these properties were observed for gluten samples, especially after exposure to 20,000 pulses. In particular, at pH 6, an increase in water and oil holding capacity of gluten was detected, while at pH 5, its solubility almost doubled. Conclusion These results suggest the potential of MIPEF to steer structure of proteins and enhance their technological functionality.

scholarly journals A SOLUBLE ANTIGEN OF LYMPHOCYTIC CHORIOMENINGITIS

1940 ◽  
Vol 71 (1) ◽  
pp. 43-53 ◽  
Author(s):  
J. E. Smadel ◽  
M. J. Wall ◽  
R. D. Baird
Keyword(s):  
Guinea Pigs ◽  
Complement Fixation ◽  
Lymphocytic Choriomeningitis ◽  
Immune Serum ◽  
Splenic Tissue ◽  
The Other ◽  
Soluble Antigen ◽  
Precipitin Reaction ◽  
Other Hand ◽  
Protein Nature

The soluble antigen of lymphocytic choriomeningitis which is readily separable from the virus is a relatively stable substance and appears to be of a protein nature. A specific precipitin reaction can be demonstrated when immune serum is added to solutions of antigen which have been freed of certain serologically inactive substances. The complement-fixation and precipitation reactions which occur in the presence of immune serum and non-infectious extracts of splenic tissue obtained from guinea pigs moribund with lymphocytic choriomeningitis seem to be manifestations of union of the same soluble antigen and its antibody. On the other hand, the antisoluble substance antibodies and neutralizing substances appear to be different entities.

Ion-Molecular Memory Model. Structural Elements of the Library Memory and the Interaction Between Them

10.12737/5934 ◽  
2014 ◽  
Vol 21 (3) ◽  
pp. 195-199
Author(s):  
Герасимов ◽  
I. Gerasimov ◽  
Яшин ◽  
A. Yashin
Keyword(s):  
Complex Interaction ◽  
Memory Model ◽  
Functional Completeness ◽  
Hydrogen Ions ◽  
Structural Elements ◽  
Molecular Memory ◽  
Protein Nature ◽  
System Memory ◽  
Physical And Chemical ◽  
Submolecular Structure

This article is a continuation of a series of works on creation of ion-molecular memory model. Structural elements of the library of memory, as well as their rather complex interaction are considered. The authors are talking about the library in anatomically formed brain. It is believed that information is stored in certain structural elements ("repository of facts"). The concept of directory information and a buffer of information systems and their capacity were introduced. The scheme of possible structure of the library of memory that includes inputs, controllers, switches, transmitters, receivers-directories, drives, and concurrently-cascaded (specialized) of the auxiliary sections of the library memory was proposed and substantiated by the authors. Structural elements of the storage of information already exist in anatomically formed brain, and actually library memory has elements of different physical sizes. Information is also distributed by the authorities, and the smallest unit patterns library memory is one where the only fact is stored. As soon hydrogen ions as carriers of information, easily contact the buffer systems, this indicates that in the system memory other structures to store facts – information are excessive, with the exception of physical and chemical buffers of protein nature. It is also clear: if more capacity information in the buffer, the more information can be stored in it. Structural elements of the library memory can be presented in sufficient functional completeness by controllers, switches, transmitters and drives. It is not excluded that controllers and switches are located within a single molecular (submolecular) structure.

scholarly journals THE IMMUNIZING ANTIGEN OF THE PNEUMOCOCCUS

1925 ◽  
Vol 42 (6) ◽  
pp. 747-752 ◽  
Author(s):  
William A. Perlzweig ◽  
Chester S. Keefer
Keyword(s):  
Broth Culture ◽  
Type I ◽  
Culture Filtrates ◽  
Protein Nature ◽  
Pneumococcus Type ◽  
Hydrion Concentration

Actively immunizing fractions of protein nature have been isolated from broth culture filtrates of Pneumococcus Type I by ultrafiltration, precipitation at a definite hydrion concentration, and the separation of a soluble picrate fraction. The method appears to be suitable for the initial purification of this antigen.

Sign in / Sign up

Export Citation Format

Share Document